General Information

  • ID:  hor002416
  • Uniprot ID:  Q7PUD4(92-101)
  • Protein name:  Myosuppressin
  • Gene name:  MSN
  • Organism:  Anopheles gambiae (African malaria mosquito)
  • Family:  Myosuppressin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  gambiae species complex, Pyretophorus, Cellia (subgenus), Anopheles (genus), Anophelinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  TDVDHVFLRF
  • Length:  10(92-101)
  • Propeptide:  MASQQIASLKAVTCVVLLLVIVCSLVAGSAMPPLCENRLIDELPPKFRKVCAALENSNQFAEALNAYIRKEAAAFLYLDDDMLVPGQTGKRTDVDHVFLRFGRRR
  • Signal peptide:  MASQQIASLKAVTCVVLLLVIVCSLVAGSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  block insect muscle activities
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 1.6*10(-8)M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7PUD4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002416_AF2.pdbhor002416_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 140912 Formula: C58H85N15O16
Absent amino acids: ACEGIKMNPQSWY Common amino acids: DFV
pI: 5.41 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 24 Boman Index: -2063
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 1323 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15629425
  • Title:  Molecular Identification of a Myosuppressin Receptor From the Malaria Mosquito Anopheles Gambiae